agentsclimarketplace

Esm2

Skill naity/FM4Life/skills/esm2

Skill for working with ESM2 protein language models from Meta FAIR. Use this skill whenever the user wants to generate protein embeddings or representations, score variant effects or predict mutation fitness, run contact prediction, or use ESMFold for structure prediction. Also trigger when the user mentions ESM2, protein language models for embeddings, zero-shot fitness prediction, or asks to featurize protein sequences for downstream ML tasks.From its SKILL.md

Install
npx -y skills add naity/FM4Life --skill esm2

Assembled from the repository path, not quoted from the project. Check it against their README if it does not work.

3 things to look at

  • 2 stars2 stars. Stars are a popularity signal and not a quality one, but at this level it is likely that nobody has read this closely except its author, and you would be relying on your own review.
  • runs commandsInstructs the agent to run 7 commands, including `pip install transformers torch` and 6 more.
  • fetches URLsInstructs the agent to fetch 1 URL, including https://esmatlas.com/resources?action=fold.

What its file declares

Copied from the file, not written here

The file declares its own license as MIT. That is the author’s claim about this one file, and it is not the same thing as the license GitHub reports for the repository, which is listed with the other numbers below.

SKILL.md

11.2 KB, ~2.9k tokens by cl100k_base, as published. Nobody here has run it

ESM2: Evolutionary Scale Modeling

Overview

ESM2 is a family of encoder-only protein language models from Meta FAIR, trained on 250M+ UniRef50 sequences. Unlike ESM3 (which is generative), ESM2 is discriminative — it cannot generate sequences but excels at:

  • Protein embeddings — dense representations for downstream ML tasks
  • Zero-shot variant effect scoring — predict mutational fitness without labels
  • Contact prediction — residue-residue contact maps from attention heads
  • Structure prediction — via ESMFold (uses ESM2 as backbone)

ESM2 is available on HuggingFace with no special SDK or API token required. The same HF API also covers ESM-1b and ESM-1v (variant-specialized) — use AutoTokenizer / AutoModel for any of them interchangeably.

Installation

pip install transformers torch

For faster inference with GPU:

pip install transformers torch accelerate

To use the fair-esm package directly (alternative, gives access to ESM-1v and ESM-IF1):

pip install fair-esm

Model Selection

HuggingFace model IDParamsLayersHidden dimUse case
facebook/esm2_t6_8M_UR50D8M6320CPU, fast prototyping
facebook/esm2_t12_35M_UR50D35M12480CPU-friendly, good quality
facebook/esm2_t30_150M_UR50D150M30640Balanced
facebook/esm2_t33_650M_UR50D650M331280Best default — GPU recommended
facebook/esm2_t36_3B_UR50D3B362560High accuracy, needs GPU
facebook/esm2_t48_15B_UR50D15B485120Max accuracy, multi-GPU

Start with esm2_t33_650M_UR50D unless compute is constrained.

Core Capabilities

1. Protein Embeddings

Extract per-residue or per-sequence embeddings for downstream tasks (classification, clustering, regression).

from transformers import EsmTokenizer, EsmModel
import torch

model_name = "facebook/esm2_t33_650M_UR50D"
tokenizer = EsmTokenizer.from_pretrained(model_name)
model = EsmModel.from_pretrained(model_name).eval()

sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWNPVLEDAFELSSMGIRVDADTLKHQLALTGDED"

inputs = tokenizer(sequence, return_tensors="pt")
with torch.no_grad():
    outputs = model(**inputs)

# Per-residue embeddings: shape (seq_len, hidden_dim)
# Slice [1:-1] to remove [CLS] and [EOS] special tokens
per_residue = outputs.last_hidden_state[0, 1:-1]

# Per-sequence embedding: mean pool over residues
per_sequence = per_residue.mean(dim=0)  # shape (hidden_dim,)

print(f"Per-residue: {per_residue.shape}")   # (L, 1280)
print(f"Per-sequence: {per_sequence.shape}") # (1280,)

See references/embeddings.md for batch processing, layer selection, and tips for downstream tasks.

2. Zero-Shot Variant Effect Scoring

Score the effect of single amino acid mutations without any labeled data, using masked marginals. A positive score means the mutation is predicted to be beneficial (or neutral); negative means deleterious.

from transformers import EsmTokenizer, EsmForMaskedLM
import torch
import torch.nn.functional as F

model_name = "facebook/esm2_t33_650M_UR50D"
tokenizer = EsmTokenizer.from_pretrained(model_name)
model = EsmForMaskedLM.from_pretrained(model_name).eval()

def score_variant(sequence, position, wt_aa, mut_aa):
    """
    Score a single-site mutation via masked marginals.
    
    Args:
        sequence: wild-type protein sequence (string)
        position: 0-indexed position of the mutation
        wt_aa: wild-type amino acid (single letter)
        mut_aa: mutant amino acid (single letter)
    
    Returns:
        float: log P(mut) - log P(wt) at the masked position.
               Positive = mutation favored by model.
    """
    masked = list(sequence)
    masked[position] = tokenizer.mask_token
    masked_seq = "".join(masked)

    inputs = tokenizer(masked_seq, return_tensors="pt")
    with torch.no_grad():
        logits = model(**inputs).logits  # (1, L+2, vocab_size)

    # +1 offset for [CLS] token
    log_probs = F.log_softmax(logits[0, position + 1], dim=-1)
    wt_id = tokenizer.convert_tokens_to_ids(wt_aa)
    mut_id = tokenizer.convert_tokens_to_ids(mut_aa)

    return (log_probs[mut_id] - log_probs[wt_id]).item()

# Example: score A2G mutation in a sequence
seq = "MAKVLGKG"
score = score_variant(seq, position=1, wt_aa="A", mut_aa="G")
print(f"A2G score: {score:.3f}")

See references/variant-scoring.md for scanning all positions, scoring multiple mutants, and comparison with ESM-1v.

3. Per-Residue Token Classification

Label each residue for tasks like secondary structure annotation, signal peptide detection, or disorder prediction. Uses EsmForTokenClassification, which adds a per-residue linear head over ESM2 representations.

from transformers import EsmTokenizer, EsmForTokenClassification
import torch

model_name = "facebook/esm2_t33_650M_UR50D"
tokenizer = EsmTokenizer.from_pretrained(model_name)

# Load a fine-tuned checkpoint for your labeling task, or train from scratch:
model = EsmForTokenClassification.from_pretrained(model_name, num_labels=3).eval()
# num_labels: e.g. 3 for helix/sheet/coil, 2 for signal/non-signal, etc.

sequence = "MKTAYIAKQRQISFVKSHFSRQ"
inputs = tokenizer(sequence, return_tensors="pt")

with torch.no_grad():
    outputs = model(**inputs)

# logits: (1, seq_len+2, num_labels) — includes [CLS] and [EOS] special tokens
logits = outputs.logits[0, 1:-1]           # strip specials → (L, num_labels)
predicted_labels = logits.argmax(dim=-1)   # (L,) — one label per residue
print(predicted_labels)

Well-known fine-tuned checkpoints are available on HuggingFace for secondary structure (3-class and 8-class) and signal peptide annotation. The base ESM2 model requires fine-tuning before its token classification outputs are meaningful.

4. Contact Prediction

ESM2 attention heads encode residue-residue contacts. Extract contact maps directly from the model.

from transformers import EsmTokenizer, EsmForProteinFolding
import torch

# Contact prediction uses the folding model
# For lightweight contact prediction without full folding, use fair-esm:
import esm

model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
batch_converter = alphabet.get_batch_converter()
model.eval()

data = [("protein1", "MKTAYIAKQRQISFVK")]
batch_labels, batch_strs, batch_tokens = batch_converter(data)

with torch.no_grad():
    results = model(batch_tokens, repr_layers=[33], return_contacts=True)

contacts = results["contacts"]  # (batch, L, L) — symmetric contact probability matrix
print(contacts.shape)

5. Structure Prediction via ESMFold

ESMFold wraps ESM2 for end-to-end structure prediction. It's fast (seconds per protein) compared to AlphaFold2 and requires only sequence input.

from transformers import EsmForProteinFolding, EsmTokenizer
import torch

tokenizer = EsmTokenizer.from_pretrained("facebook/esmfold_v1")
model = EsmForProteinFolding.from_pretrained("facebook/esmfold_v1", low_cpu_mem_usage=True)
model.eval()

sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD"
inputs = tokenizer([sequence], return_tensors="pt", add_special_tokens=False)

with torch.no_grad():
    output = model(**inputs)

# Convert to PDB
from transformers.models.esm.openfold_utils.protein import to_pdb, Protein as OFProtein
from transformers.models.esm.openfold_utils.feats import atom14_to_atom37

# Helper to save PDB
def output_to_pdb(model_output):
    final_atom_positions = atom14_to_atom37(model_output["positions"][-1], model_output)
    model_output = {k: v.to("cpu").numpy() for k, v in model_output.items()}
    final_atom_positions = final_atom_positions.cpu().numpy()
    pdbs = []
    for i in range(model_output["aatype"].shape[0]):
        aa = model_output["aatype"][i]
        pred_pos = final_atom_positions[i]
        mask = model_output["atom37_atom_exists"][i]
        resid = model_output["residue_index"][i] + 1
        pdbs.append(to_pdb(OFProtein(
            aatype=aa, atom_positions=pred_pos, atom_mask=mask,
            residue_index=resid, b_factors=np.zeros_like(mask),
            chain_index=model_output.get("chain_index", [None] * len(aa))[i],
        )))
    return pdbs

pdb_strings = output_to_pdb(output)
with open("predicted.pdb", "w") as f:
    f.write(pdb_strings[0])

Note: ESMFold requires ~16GB GPU RAM for typical proteins. For CPU-only or large batches, consider the ESMFold web API at https://esmatlas.com/resources?action=fold.

Best Practices

  • Special tokens: always strip [CLS] (index 0) and [EOS] (index -1) from last_hidden_state before using per-residue embeddings
  • Sequence length: ESM2 supports up to 1022 residues (max_position_embeddings=1026 minus 2 special tokens minus 2 padding); longer sequences must be chunked or truncated
  • Normalization: L2-normalize per-sequence embeddings before computing cosine similarity
  • Layer choice: last layer is best for structure-related tasks; middle layers (e.g., layer 20 of 33) can be better for evolutionary/functional tasks — see references/embeddings.md
  • Variant scoring at scale: for scanning all positions in a sequence, batch the masked inputs rather than running one forward pass per position

Scripts

Bundled CLI scripts for common workflows — no setup beyond pip install transformers torch:

# Batch embed a FASTA file → .npy or HDF5
python scripts/embed.py sequences.fasta --output embeddings.npy

# Scan all single-site mutations for a sequence
python scripts/scan_variants.py MKTAYIAKQRQISFVK --output scores.csv --heatmap landscape.png

# Score specific named variants
python scripts/scan_variants.py MKTAYIAKQRQISFVK --variants A2G K4R T3S

# Use a smaller model for faster prototyping
python scripts/embed.py sequences.fasta --model facebook/esm2_t12_35M_UR50D --output embeddings.npy

Resources

References

  • references/embeddings.md — batch processing, layer selection, normalization, downstream task tips
  • references/variant-scoring.md — full position scanning, multi-mutant scoring, ESM-1v comparison, benchmarks
  • scripts/embed.py — batch FASTA → embeddings CLI
  • scripts/scan_variants.py — mutation landscape scan and named variant scoring CLI

What ships with it: 4 files

22.4 KB alongside SKILL.md, 2 of them executable

references/

scripts/

Keep looking

Skills are one crate of 325,949. Ordering is by how many stacks a row turns up in, so the top of any crate is what has actually been picked rather than what has the most stars.