Alphafold3
Skill for structure prediction with AlphaFold 3 (AF3) from Google DeepMind. Use this skill when a user wants to predict the structure of a protein complex with ligands, DNA, or RNA; predict protein-ligand binding poses; model protein-nucleic acid interactions; use SMILES or CCD codes to specify small molecules; parse AF3 mmCIF or confidence JSON outputs; or work with AF3's structured JSON input format. AF3 handles mixed biomolecular systems that AF2 cannot model. Also trigger when the user mentions AlphaFold 3, AF3, alphafoldserver.com, protein-ligand structure prediction, PTMs (post-translational modifications), or drug-target structure modeling.From its SKILL.md
npx -y skills add naity/FM4Life --skill alphafold3Assembled from the repository path, not quoted from the project. Check it against their README if it does not work.
2 things to look at
- 2 stars2 stars. Stars are a popularity signal and not a quality one, but at this level it is likely that nobody has read this closely except its author, and you would be relying on your own review.
- runs commandsInstructs the agent to run 5 commands, including `git clone https://github.com/google-deepmind/alphafold3.git && cd alphafold3` and 4 more.
What its file declares
Copied from the file, not written here
The file declares its own license as CC-BY-NC-SA 4.0 (source); separate non-commercial terms for model weights. That is the author’s claim about this one file, and it is not the same thing as the license GitHub reports for the repository, which is listed with the other numbers below.
SKILL.md
8.1 KB, ~2.2k tokens by cl100k_base, as published. Nobody here has run it
AlphaFold 3: Biomolecular Structure Prediction
Overview
AlphaFold 3 predicts the structure of mixed biomolecular systems in a single unified model:
- Proteins (including post-translational modifications)
- RNA and DNA (including modified bases)
- Small molecule ligands (via CCD codes or SMILES)
- Ions and cofactors
- Covalently modified residues
This makes AF3 the tool of choice when your system contains anything beyond a bare protein. For pure protein structure prediction, AlphaFold 2 / ColabFold remains widely used and well-benchmarked.
⚠️ License and Access
AF3 is non-commercial only. Key constraints:
- Source code: CC-BY-NC-SA 4.0 — non-commercial use only
- Model weights: separate terms of use — must apply directly from Google; commercial use requires a separate agreement
- Outputs: subject to output terms of use
For commercial use, check with Google DeepMind directly.
Access Options
Option 1: Web Server (fastest, no install)
https://alphafoldserver.com — free, up to 20 jobs/day, no installation required. Best for:
- Exploratory work
- Single predictions
- Proteins + limited ligand set
The web server uses a slightly simplified JSON format (alphafoldserver dialect) and has a more limited set of ligands and covalent modifications than the local install.
Option 2: Local Install (full capabilities)
Requires:
- Linux (Ubuntu 22.04 recommended)
- NVIDIA GPU with Compute Capability ≥ 8.0 (A100 or H100 80GB)
- ≥ 64 GB RAM
- ~1 TB disk for databases (SSD recommended)
- Model weights from Google (apply here)
# Clone and build Docker image
git clone https://github.com/google-deepmind/alphafold3.git && cd alphafold3
docker build -t alphafold3 -f docker/Dockerfile .
# Download databases (~600 GB download)
bash fetch_databases.sh /data/af3_databases
# Run prediction
docker run -it \
--volume $HOME/af_input:/root/af_input \
--volume $HOME/af_output:/root/af_output \
--volume /data/af3_models:/root/models \
--volume /data/af3_databases:/root/public_databases \
--gpus all \
alphafold3 \
python run_alphafold.py \
--json_path=/root/af_input/input.json \
--model_dir=/root/models \
--output_dir=/root/af_output
Two-stage pipeline:
--run_data_pipeline=true(default) — MSA and template search, CPU-only, run separately on a compute node--run_inference=true(default) — structure prediction, requires GPU
Input JSON Format
Unlike AF2 (FASTA input), AF3 uses a structured JSON file specifying every molecular entity. Each entity gets a chain ID.
Minimal example: single protein
{
"name": "my_protein",
"modelSeeds": [1, 2, 3],
"sequences": [
{
"protein": {
"id": "A",
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD"
}
}
],
"dialect": "alphafold3",
"version": 1
}
Protein–ligand complex
{
"name": "kinase_atp",
"modelSeeds": [1],
"sequences": [
{
"protein": {
"id": "A",
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD"
}
},
{
"ligand": {
"id": "B",
"ccdCodes": ["ATP"]
}
},
{
"ligand": {
"id": "C",
"ccdCodes": ["MG"]
}
}
],
"dialect": "alphafold3",
"version": 1
}
Protein–DNA complex
{
"name": "transcription_factor",
"modelSeeds": [1],
"sequences": [
{
"protein": {
"id": "A",
"sequence": "MKTAYIAKQRQISFVK"
}
},
{
"dna": {
"id": ["B", "C"],
"sequence": "GACCTCTGAGGT"
}
}
],
"dialect": "alphafold3",
"version": 1
}
Custom ligand via SMILES
{
"ligand": {
"id": "B",
"smiles": "CC(=O)Nc1ccc(O)cc1"
}
}
Note: backslashes in SMILES must be escaped as \\ in JSON.
Homomeric complex (multiple copies of the same chain)
{
"protein": {
"id": ["A", "B", "C"],
"sequence": "MKTAYIAKQRQISFVK"
}
}
Post-translational modifications
{
"protein": {
"id": "A",
"sequence": "PVLSCGEWQL",
"modifications": [
{"ptmType": "SEP", "ptmPosition": 3},
{"ptmType": "TPO", "ptmPosition": 7}
]
}
}
See references/input-format.md for the full entity type reference, covalent bonds, custom MSA, and template specification.
Building Input JSON Programmatically
python scripts/build_input.py \
--name my_complex \
--protein "MKTAYIAKQRQISFVK" \
--ligand-ccd ATP MG \
--seeds 1 2 3 \
--output input.json
Output Format
AF3 outputs mmCIF files (not PDB) plus JSON confidence files.
<job_name>/
├── <job_name>_model.cif ← best prediction (top ranking_score)
├── <job_name>_confidences.json ← full confidence arrays for best model
├── <job_name>_summary_confidences.json ← summary metrics for best model
├── <job_name>_ranking_scores.csv ← all predictions ranked
├── seed-1_sample-0/ ← all individual predictions
│ ├── *_model.cif
│ ├── *_confidences.json
│ └── *_summary_confidences.json
└── seed-1_sample-1/ ...
Key confidence metrics
| Metric | Type | Range | Interpretation |
|---|---|---|---|
atom_plddts | per-atom array | 0–100 | Local confidence; >70 = reliable |
pae | N×N matrix | 0–∞ Å | Relative position error; low = confident |
ptm | scalar | 0–1 | Global fold confidence; >0.5 = plausible |
iptm | scalar | 0–1 | Interface confidence; >0.8 = high, <0.6 = failed |
chain_pair_pae_min | M×M matrix | 0–∞ Å | Inter-chain interaction confidence |
contact_probs | N×N matrix | 0–1 | Probability of contact (<8 Å) |
ranking_score | scalar | 0.8×iptm + 0.2×ptm + 0.5×disorder − 100×has_clash |
Note: AF3 pLDDT is per-atom (not per-residue like AF2). For proteins, mean per-residue pLDDT can be derived by averaging atoms in each residue.
See references/outputs.md for parsing mmCIF and confidence JSON in Python.
AF3 vs AF2 Comparison
| AlphaFold 2 | AlphaFold 3 | |
|---|---|---|
| Input format | FASTA | JSON |
| Output format | PDB | mmCIF |
| Proteins | ✓ | ✓ |
| Protein complexes | ✓ (Multimer) | ✓ |
| RNA/DNA | ✗ | ✓ |
| Small molecule ligands | ✗ | ✓ |
| PTMs / modified bases | ✗ | ✓ |
| License | Apache 2.0 | CC-BY-NC-SA 4.0 |
| Model weights | CC BY 4.0 | Non-commercial only |
| Web server | AFDB (precomputed) | alphafoldserver.com |
Resources
- Web server: https://alphafoldserver.com
- GitHub: https://github.com/google-deepmind/alphafold3
- Model weights request: https://forms.gle/svvpY4u2jsHEwWYS6
- Paper: Abramson et al., Nature 2024 — https://doi.org/10.1038/s41586-024-07487-w
References
references/input-format.md— full JSON schema: RNA, DNA, ligands, PTMs, covalent bonds, custom MSA, templatesreferences/outputs.md— parsing mmCIF structures, confidence JSON, embeddings, contact probabilities
What ships with it: 3 files
36.4 KB alongside SKILL.md, 1 of them executable
references/
- input-format.md10.8 KB
- outputs.md13.0 KB
scripts/
- build_input.pyruns12.6 KB