Ai science esm2 embeddings
Skill Pavel-Kravchenko/Bioinformatics/Skills/ai-science-esm2-embeddings
Generate ESM2 protein embeddings (fair-esm/transformers) and predict structure with ESMFold. Use when embedding sequences, scoring mutations zero-shot, annotating protein function, or doing fast MSA-free structure prediction.From its SKILL.md
npx -y skills add Pavel-Kravchenko/Bioinformatics --skill ai-science-esm2-embeddingsAssembled from the repository path, not quoted from the project. Check it against their README if it does not work.
2 things to look at
- no licenseNo license file was found in the repository. Code published without one is not open source by default, so using it at work is a question for whoever answers licensing questions where you are.
- 4 stars4 stars. Stars are a popularity signal and not a quality one, but at this level it is likely that nobody has read this closely except its author, and you would be relying on your own review.
SKILL.md
9.0 KB, ~2.5k tokens by cl100k_base, as published. Nobody here has run it
ESM2 Embeddings and ESMFold
When to Use
- Need a fixed-length vector representation of a protein sequence for downstream ML (classification, clustering, similarity search)
- Scoring point mutations / variants zero-shot without labeled training data
- Predicting a 3D structure quickly (no MSA) for screening before a slower AlphaFold2 run
- Annotating protein function or detecting homology when a sequence has no close characterized relatives
- Extracting per-residue features for binding-site, disorder, or secondary-structure prediction
Version Compatibility
fair-esm2.0.0 (import nameesm), PyTorch ≥2.0, Python ≥3.9- Alternative: HuggingFace
transformers≥4.30 (EsmModel/EsmForMaskedLM, checkpointsfacebook/esm2_t33_650M_UR50D, etc.) — same weights, nofair-esmdependency - ESMFold requires an additional
pip install "fair-esm[esmfold]"plusopenfold; GPU with ≥16GB VRAM recommended for the 650M+ models
Prerequisites
pip install fair-esm torch(orpip install transformers torch)- GPU strongly recommended for anything above ESM2-150M; CPU is fine for embedding extraction on short sequences with the 8M/35M models
- Familiarity with protein FASTA format and basic PyTorch tensor ops
ESM2 Architecture
ESM2 (Lin et al., 2023, Science) is a transformer protein language model trained with masked-language-modeling (~15% masking) on UniRef50/90 (~65M unique training sequences).
| Model | Layers | Embedding dim | Params |
|---|---|---|---|
| ESM2-8M | 6 | 320 | 8M |
| ESM2-35M | 12 | 480 | 35M |
| ESM2-150M | 30 | 640 | 150M |
| ESM2-650M | 33 | 1280 | 650M |
| ESM2-3B | 36 | 2560 | 3B |
| ESM2-15B | 48 | 5120 | 15B |
ESM2-650M is the sweet spot for most tasks (single GPU, strong signal). Tokenization is one token per amino acid (33-token vocabulary: 20 standard AAs + B/U/Z/O + <cls>/<eos>/<pad>/<mask>/<unk>) — no k-mer/subword splitting, so a 500-residue protein is 502 tokens.
Despite no structural supervision, ESM2 representations predict secondary structure (~80% linear-probe accuracy), contact maps (from attention), enzymatic function (same EC number clusters together), and evolutionary distance (correlates with embedding cosine similarity).
Extracting Embeddings
Goal: get a per-residue or mean-pooled vector for one or more protein sequences.
Approach: load ESM2 via fair-esm, batch-encode sequences, run a forward pass with repr_layers set to the layer(s) you want, then pool over the residue axis (excluding <cls>/<eos>).
# pip install fair-esm torch
import esm
import torch
def embed_sequences(sequences: dict[str, str], layer: int = 33, device: str = "cpu"):
"""Return {name: (per_residue_emb, mean_emb)} using ESM2-650M.
per_residue_emb: (seq_len, 1280) tensor, one row per amino acid.
mean_emb: (1280,) tensor, mean-pooled over residues (excludes <cls>/<eos>).
"""
model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
model = model.eval().to(device)
batch_converter = alphabet.get_batch_converter()
data = list(sequences.items())
_, _, batch_tokens = batch_converter(data)
batch_tokens = batch_tokens.to(device)
with torch.no_grad():
out = model(batch_tokens, repr_layers=[layer], return_contacts=False)
reps = out["representations"][layer]
results = {}
for i, (name, seq) in enumerate(data):
per_residue = reps[i, 1 : len(seq) + 1] # drop <cls> (pos 0) and <eos>
results[name] = (per_residue.cpu(), per_residue.mean(0).cpu())
return results
if __name__ == "__main__":
seqs = {
"protein1": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ",
"protein2": "ACDEFGHIKLMNPQRSTVWY",
}
embeddings = embed_sequences(seqs)
for name, (per_res, mean_vec) in embeddings.items():
assert per_res.shape == (len(seqs[name]), 1280)
assert mean_vec.shape == (1280,)
print(name, "per-residue:", tuple(per_res.shape), "mean:", tuple(mean_vec.shape))
Use mean pooling for sequence-level tasks (classification, clustering); use per-residue vectors for residue-level tasks (variant scoring, binding-site prediction). Extract from the last layer (33 for ESM2-650M) for most tasks; intermediate layers can help structural probes.
ESMFold Structure Prediction
Goal: predict a 3D structure from sequence alone, without an MSA search.
Approach: load the ESMFold wrapper (ESM2-3B + folding trunk), run infer_pdb, then read the pLDDT confidence out of the B-factor column.
# pip install "fair-esm[esmfold]" torch openfold
import esm
import torch
def predict_structure(sequence: str, out_path: str = "predicted.pdb") -> str:
"""Predict structure with ESMFold and write a PDB file. Returns the PDB text."""
model = esm.pretrained.esmfold_v1().eval()
if torch.cuda.is_available():
model = model.cuda()
with torch.no_grad():
pdb_str = model.infer_pdb(sequence)
with open(out_path, "w") as f:
f.write(pdb_str)
return pdb_str
def confidence_bucket(mean_plddt: float) -> str:
"""Bucket a mean pLDDT score (0-100) using the standard AlphaFold2/ESMFold thresholds."""
if mean_plddt >= 90:
return "very_high"
if mean_plddt >= 70:
return "usable"
if mean_plddt >= 50:
return "low"
return "very_low"
if __name__ == "__main__":
for v, expected in [(96, "very_high"), (82, "usable"), (63, "low"), (41, "very_low")]:
assert confidence_bucket(v) == expected
print("confidence_bucket checks passed")
ESMFold is ~10-60x faster than AlphaFold2 (no MSA) with comparable accuracy on easy targets, but degrades on proteins with many homologs where MSA-derived co-evolution signal matters. Use ESMFold for rapid screening, AF2 for final structural analysis. No-GPU option: POST the sequence to https://api.esmatlas.com/foldSequence/v1/pdb/ and save the response text as a PDB.
Amino Acid Composition Baseline
Always benchmark ESM2 against this trivial baseline first — if ESM2 doesn't beat it, the task may be composition-dependent rather than context-dependent, and you don't need a language model.
import numpy as np
np.random.seed(9)
AA = list("ACDEFGHIKLMNPQRSTVWY")
AA_INDEX = {a: i for i, a in enumerate(AA)}
def toy_embed(seq: str) -> np.ndarray:
"""20-aa composition frequency + normalized length as a 21-dim baseline embedding."""
vec = np.zeros(21, dtype=float)
for a in seq:
if a in AA_INDEX:
vec[AA_INDEX[a]] += 1
if len(seq) > 0:
vec[:20] /= len(seq)
vec[20] = min(len(seq) / 500.0, 1.0)
return vec
def random_protein(n: int) -> str:
return "".join(np.random.choice(AA, size=n))
def inject_motif(seq: str, motif: str, pos: int) -> str:
return seq[:pos] + motif + seq[pos + len(motif):]
if __name__ == "__main__":
N, motif = 200, "HGH"
seqs, y = [], []
for _ in range(N):
s = random_protein(80)
if np.random.rand() < 0.5:
s = inject_motif(s, motif, 25)
y.append(1)
else:
y.append(0)
seqs.append(s)
X = np.vstack([toy_embed(s) for s in seqs])
y = np.array(y)
train, test = np.arange(150), np.arange(150, N)
c0 = X[train][y[train] == 0].mean(axis=0)
c1 = X[train][y[train] == 1].mean(axis=0)
pred = (((X[test] - c1) ** 2).sum(axis=1) < ((X[test] - c0) ** 2).sum(axis=1)).astype(int)
acc = float((pred == y[test]).mean())
assert 0.0 <= acc <= 1.0
print("Composition-probe accuracy:", acc)
Pitfalls
- Off-by-one on
<cls>/<eos>: per-residue slicing must use[1 : len(seq)+1]— forgetting to drop<cls>shifts every residue index by one - Layer index depends on model size:
repr_layers=[33]is correct only for ESM2-650M (33 layers); use the model's own layer count (e.g.[12]for ESM2-35M), not a hardcoded 33 - Sequence length limits: attention is O(n²) in sequence length; very long proteins (>1000 aa) need chunking or a smaller model to fit GPU memory
- ESMFold accuracy drop on homolog-rich families: skipping the MSA loses co-evolution signal AF2 exploits — cross-check low-confidence ESMFold regions with AF2 before trusting them
fair-esmis largely unmaintained: for new projects prefer HuggingFacetransformers(EsmModel.from_pretrained("facebook/esm2_t33_650M_UR50D")) for the same weights with active support
See Also
esm— broader ESM model family usage (ESM-1v, ESM-IF1) beyond embeddings/ESMFoldbio-structural-biology-alphafold-predictions— AlphaFold2 structure prediction for final/high-accuracy analysisbio-structural-biology-modern-structure-prediction— comparing modern structure predictors including ESMFoldalphafold-database— fetching precomputed AlphaFold structures instead of predicting from scratch
What ships with it
Read from the repository
Just SKILL.md. No reference files, no scripts.