agentsclimarketplace

Ai science esm2 embeddings

Skill Pavel-Kravchenko/Bioinformatics/Skills/ai-science-esm2-embeddings

Generate ESM2 protein embeddings (fair-esm/transformers) and predict structure with ESMFold. Use when embedding sequences, scoring mutations zero-shot, annotating protein function, or doing fast MSA-free structure prediction.From its SKILL.md

Install
npx -y skills add Pavel-Kravchenko/Bioinformatics --skill ai-science-esm2-embeddings

Assembled from the repository path, not quoted from the project. Check it against their README if it does not work.

2 things to look at

  • no licenseNo license file was found in the repository. Code published without one is not open source by default, so using it at work is a question for whoever answers licensing questions where you are.
  • 4 stars4 stars. Stars are a popularity signal and not a quality one, but at this level it is likely that nobody has read this closely except its author, and you would be relying on your own review.

SKILL.md

9.0 KB, ~2.5k tokens by cl100k_base, as published. Nobody here has run it

ESM2 Embeddings and ESMFold

When to Use

  • Need a fixed-length vector representation of a protein sequence for downstream ML (classification, clustering, similarity search)
  • Scoring point mutations / variants zero-shot without labeled training data
  • Predicting a 3D structure quickly (no MSA) for screening before a slower AlphaFold2 run
  • Annotating protein function or detecting homology when a sequence has no close characterized relatives
  • Extracting per-residue features for binding-site, disorder, or secondary-structure prediction

Version Compatibility

  • fair-esm 2.0.0 (import name esm), PyTorch ≥2.0, Python ≥3.9
  • Alternative: HuggingFace transformers ≥4.30 (EsmModel/EsmForMaskedLM, checkpoints facebook/esm2_t33_650M_UR50D, etc.) — same weights, no fair-esm dependency
  • ESMFold requires an additional pip install "fair-esm[esmfold]" plus openfold; GPU with ≥16GB VRAM recommended for the 650M+ models

Prerequisites

  • pip install fair-esm torch (or pip install transformers torch)
  • GPU strongly recommended for anything above ESM2-150M; CPU is fine for embedding extraction on short sequences with the 8M/35M models
  • Familiarity with protein FASTA format and basic PyTorch tensor ops

ESM2 Architecture

ESM2 (Lin et al., 2023, Science) is a transformer protein language model trained with masked-language-modeling (~15% masking) on UniRef50/90 (~65M unique training sequences).

ModelLayersEmbedding dimParams
ESM2-8M63208M
ESM2-35M1248035M
ESM2-150M30640150M
ESM2-650M331280650M
ESM2-3B3625603B
ESM2-15B48512015B

ESM2-650M is the sweet spot for most tasks (single GPU, strong signal). Tokenization is one token per amino acid (33-token vocabulary: 20 standard AAs + B/U/Z/O + <cls>/<eos>/<pad>/<mask>/<unk>) — no k-mer/subword splitting, so a 500-residue protein is 502 tokens.

Despite no structural supervision, ESM2 representations predict secondary structure (~80% linear-probe accuracy), contact maps (from attention), enzymatic function (same EC number clusters together), and evolutionary distance (correlates with embedding cosine similarity).

Extracting Embeddings

Goal: get a per-residue or mean-pooled vector for one or more protein sequences. Approach: load ESM2 via fair-esm, batch-encode sequences, run a forward pass with repr_layers set to the layer(s) you want, then pool over the residue axis (excluding <cls>/<eos>).

# pip install fair-esm torch
import esm
import torch


def embed_sequences(sequences: dict[str, str], layer: int = 33, device: str = "cpu"):
    """Return {name: (per_residue_emb, mean_emb)} using ESM2-650M.

    per_residue_emb: (seq_len, 1280) tensor, one row per amino acid.
    mean_emb: (1280,) tensor, mean-pooled over residues (excludes <cls>/<eos>).
    """
    model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
    model = model.eval().to(device)
    batch_converter = alphabet.get_batch_converter()

    data = list(sequences.items())
    _, _, batch_tokens = batch_converter(data)
    batch_tokens = batch_tokens.to(device)

    with torch.no_grad():
        out = model(batch_tokens, repr_layers=[layer], return_contacts=False)
    reps = out["representations"][layer]

    results = {}
    for i, (name, seq) in enumerate(data):
        per_residue = reps[i, 1 : len(seq) + 1]  # drop <cls> (pos 0) and <eos>
        results[name] = (per_residue.cpu(), per_residue.mean(0).cpu())
    return results


if __name__ == "__main__":
    seqs = {
        "protein1": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ",
        "protein2": "ACDEFGHIKLMNPQRSTVWY",
    }
    embeddings = embed_sequences(seqs)
    for name, (per_res, mean_vec) in embeddings.items():
        assert per_res.shape == (len(seqs[name]), 1280)
        assert mean_vec.shape == (1280,)
        print(name, "per-residue:", tuple(per_res.shape), "mean:", tuple(mean_vec.shape))

Use mean pooling for sequence-level tasks (classification, clustering); use per-residue vectors for residue-level tasks (variant scoring, binding-site prediction). Extract from the last layer (33 for ESM2-650M) for most tasks; intermediate layers can help structural probes.

ESMFold Structure Prediction

Goal: predict a 3D structure from sequence alone, without an MSA search. Approach: load the ESMFold wrapper (ESM2-3B + folding trunk), run infer_pdb, then read the pLDDT confidence out of the B-factor column.

# pip install "fair-esm[esmfold]" torch openfold
import esm
import torch


def predict_structure(sequence: str, out_path: str = "predicted.pdb") -> str:
    """Predict structure with ESMFold and write a PDB file. Returns the PDB text."""
    model = esm.pretrained.esmfold_v1().eval()
    if torch.cuda.is_available():
        model = model.cuda()
    with torch.no_grad():
        pdb_str = model.infer_pdb(sequence)
    with open(out_path, "w") as f:
        f.write(pdb_str)
    return pdb_str


def confidence_bucket(mean_plddt: float) -> str:
    """Bucket a mean pLDDT score (0-100) using the standard AlphaFold2/ESMFold thresholds."""
    if mean_plddt >= 90:
        return "very_high"
    if mean_plddt >= 70:
        return "usable"
    if mean_plddt >= 50:
        return "low"
    return "very_low"


if __name__ == "__main__":
    for v, expected in [(96, "very_high"), (82, "usable"), (63, "low"), (41, "very_low")]:
        assert confidence_bucket(v) == expected
    print("confidence_bucket checks passed")

ESMFold is ~10-60x faster than AlphaFold2 (no MSA) with comparable accuracy on easy targets, but degrades on proteins with many homologs where MSA-derived co-evolution signal matters. Use ESMFold for rapid screening, AF2 for final structural analysis. No-GPU option: POST the sequence to https://api.esmatlas.com/foldSequence/v1/pdb/ and save the response text as a PDB.

Amino Acid Composition Baseline

Always benchmark ESM2 against this trivial baseline first — if ESM2 doesn't beat it, the task may be composition-dependent rather than context-dependent, and you don't need a language model.

import numpy as np

np.random.seed(9)
AA = list("ACDEFGHIKLMNPQRSTVWY")
AA_INDEX = {a: i for i, a in enumerate(AA)}


def toy_embed(seq: str) -> np.ndarray:
    """20-aa composition frequency + normalized length as a 21-dim baseline embedding."""
    vec = np.zeros(21, dtype=float)
    for a in seq:
        if a in AA_INDEX:
            vec[AA_INDEX[a]] += 1
    if len(seq) > 0:
        vec[:20] /= len(seq)
    vec[20] = min(len(seq) / 500.0, 1.0)
    return vec


def random_protein(n: int) -> str:
    return "".join(np.random.choice(AA, size=n))


def inject_motif(seq: str, motif: str, pos: int) -> str:
    return seq[:pos] + motif + seq[pos + len(motif):]


if __name__ == "__main__":
    N, motif = 200, "HGH"
    seqs, y = [], []
    for _ in range(N):
        s = random_protein(80)
        if np.random.rand() < 0.5:
            s = inject_motif(s, motif, 25)
            y.append(1)
        else:
            y.append(0)
        seqs.append(s)

    X = np.vstack([toy_embed(s) for s in seqs])
    y = np.array(y)
    train, test = np.arange(150), np.arange(150, N)
    c0 = X[train][y[train] == 0].mean(axis=0)
    c1 = X[train][y[train] == 1].mean(axis=0)
    pred = (((X[test] - c1) ** 2).sum(axis=1) < ((X[test] - c0) ** 2).sum(axis=1)).astype(int)
    acc = float((pred == y[test]).mean())
    assert 0.0 <= acc <= 1.0
    print("Composition-probe accuracy:", acc)

Pitfalls

  • Off-by-one on <cls>/<eos>: per-residue slicing must use [1 : len(seq)+1] — forgetting to drop <cls> shifts every residue index by one
  • Layer index depends on model size: repr_layers=[33] is correct only for ESM2-650M (33 layers); use the model's own layer count (e.g. [12] for ESM2-35M), not a hardcoded 33
  • Sequence length limits: attention is O(n²) in sequence length; very long proteins (>1000 aa) need chunking or a smaller model to fit GPU memory
  • ESMFold accuracy drop on homolog-rich families: skipping the MSA loses co-evolution signal AF2 exploits — cross-check low-confidence ESMFold regions with AF2 before trusting them
  • fair-esm is largely unmaintained: for new projects prefer HuggingFace transformers (EsmModel.from_pretrained("facebook/esm2_t33_650M_UR50D")) for the same weights with active support

See Also

  • esm — broader ESM model family usage (ESM-1v, ESM-IF1) beyond embeddings/ESMFold
  • bio-structural-biology-alphafold-predictions — AlphaFold2 structure prediction for final/high-accuracy analysis
  • bio-structural-biology-modern-structure-prediction — comparing modern structure predictors including ESMFold
  • alphafold-database — fetching precomputed AlphaFold structures instead of predicting from scratch

What ships with it

Read from the repository

Just SKILL.md. No reference files, no scripts.

Keep looking

Skills are one crate of 325,949. Ordering is by how many stacks a row turns up in, so the top of any crate is what has actually been picked rather than what has the most stars.