Gget genomic databases
Skill BioTender-max/awesome-bio-agent-skills/skills/sciagent/gget-genomic-databases
Unified CLI/Python interface to 20+ genomic databases. Gene lookups (Ensembl search/info/seq), BLAST/BLAT, AlphaFold, Enrichr enrichment, OpenTargets disease/drug, CELLxGENE single-cell, cBioPortal/COSMIC cancer, ARCHS4 expression. Spans genomics, proteomics, disease. For batch/advanced BLAST use biopython; for multi-DB Python SDK use bioservices.From its SKILL.md
npx -y skills add BioTender-max/awesome-bio-agent-skills --skill gget-genomic-databasesAssembled from the repository path, not quoted from the project. Check it against their README if it does not work.
One thing to look at
- no licenseNo license file was found in the repository. Code published without one is not open source by default, so using it at work is a question for whoever answers licensing questions where you are.
What its file declares
Copied from the file, not written here
The file declares its own license as BSD-2-Clause. That is the author’s claim about this one file, and it is not the same thing as the license GitHub reports for the repository, which is listed with the other numbers below.
SKILL.md
20.6 KB, ~5.6k tokens by cl100k_base, as published. Nobody here has run it
gget — Unified Genomic Database Access
Overview
gget is a command-line and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequences, protein structures, expression data, and disease associations through a consistent interface. All modules work as both CLI tools and Python functions, returning DataFrames (Python) or JSON/CSV (CLI).
When to Use
- Looking up gene information (names, IDs, descriptions) across species from Ensembl
- Retrieving nucleotide or protein sequences for Ensembl gene/transcript IDs
- Running BLAST or BLAT searches against standard reference databases
- Predicting protein 3D structures with AlphaFold2 from amino acid sequences
- Performing gene set enrichment analysis (GO, KEGG, disease terms) via Enrichr
- Querying single-cell RNA-seq datasets from CELLxGENE Census
- Finding disease and drug associations for a gene target via OpenTargets
- Downloading Ensembl reference genomes and annotations for a species
- Finding cancer mutations and genomic alterations via cBioPortal or COSMIC
- Getting tissue expression and correlated genes from ARCHS4
- For batch processing or advanced BLAST parameters, use
biopythoninstead - For programmatic multi-database workflows with rate limiting, use
bioservicesinstead
Prerequisites
- Python packages:
gget - Optional setup: Some modules require
gget setup <module>before first use (alphafold, cellxgene, elm, gpt) - Environment: Clean virtual environment recommended to avoid dependency conflicts
- API notes: gget queries remote databases — rate-limit large batch queries with
time.sleep(). Databases update biweekly; keep gget updated. Max ~1000 Ensembl IDs pergget.info()call
pip install gget
# Optional: setup modules that need additional dependencies
gget setup alphafold # ~4GB model parameters, requires OpenMM
gget setup cellxgene # cellxgene-census package
gget setup elm # local ELM database
Quick Start
import gget
# Search for genes by keyword
results = gget.search(["BRCA1", "tumor suppressor"], species="homo_sapiens")
print(f"Found {len(results)} genes")
# Get detailed gene information (Ensembl + UniProt + NCBI)
info = gget.info(["ENSG00000012048"])
print(f"Gene: {info.iloc[0]['primary_gene_name']}")
# Enrichment analysis on a gene list
enrichment = gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology")
print(f"Enriched terms: {len(enrichment)}")
Core API
Module 1: Reference & Gene Search (ref, search, info, seq)
Query Ensembl for gene references, search by keywords, retrieve gene metadata, and fetch sequences.
import gget
# Search for genes by keyword
results = gget.search(["BRCA1", "tumor suppressor"], species="homo_sapiens")
print(f"Found {len(results)} genes")
print(results[["ensembl_id", "gene_name", "biotype"]].head())
# Get detailed gene information (Ensembl + UniProt + NCBI)
info = gget.info(["ENSG00000012048", "ENSG00000139618"])
print(f"Gene info columns: {list(info.columns)}")
import gget
# Retrieve sequences
nucleotide_seqs = gget.seq(["ENSG00000012048"])
protein_seqs = gget.seq(["ENSG00000012048"], translate=True, isoforms=True)
print(f"Retrieved {len(protein_seqs)} isoform sequences")
# Download reference genome files (specify release for reproducibility)
ref_links = gget.ref("homo_sapiens", which="gtf", release=112)
print(f"GTF download link: {ref_links}")
Module 2: Sequence Alignment (blast, blat, muscle, diamond)
BLAST/BLAT remote searches, multiple sequence alignment, and fast local alignment.
import gget
import time
# BLAST against SwissProt (remote API — add delay for batch queries)
blast_results = gget.blast(
"MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR",
database="swissprot", limit=10
)
print(f"Top hit: {blast_results.iloc[0]['Description']}, E-value: {blast_results.iloc[0]['e-value']}")
time.sleep(2) # Rate-limit between BLAST queries
# BLAT — find genomic position (UCSC)
blat_results = gget.blat("ATCGATCGATCGATCGATCG", assembly="human")
print(f"Genomic location: chr{blat_results.iloc[0]['chromosome']}:{blat_results.iloc[0]['start']}")
import gget
# Multiple sequence alignment with Muscle5
aligned = gget.muscle("sequences.fasta", save=True)
# Fast local alignment with DIAMOND (local, no rate limit needed)
diamond_results = gget.diamond(
"GGETISAWESQME",
reference="reference.fasta",
sensitivity="very-sensitive",
threads=4
)
print(f"Alignments found: {len(diamond_results)}")
Module 3: Protein Structure (pdb, alphafold, elm)
Download PDB structures, predict structures with AlphaFold2, find linear motifs.
import gget
# Download PDB structure
pdb_data = gget.pdb("7S7U", save=True)
# Predict structure with AlphaFold2 (requires gget setup alphafold)
structure = gget.alphafold(
"MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR",
plot=True, show_sidechains=True
)
print("Structure prediction complete, PDB file saved")
import gget
# Find Eukaryotic Linear Motifs (requires gget setup elm)
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
print(f"Ortholog motifs: {len(ortholog_df)}, Regex motifs: {len(regex_df)}")
Module 4: Expression & Correlation (archs4, cellxgene, bgee)
Gene expression, tissue expression, correlated genes, single-cell data.
import gget
# Tissue expression from ARCHS4
tissue_expr = gget.archs4("ACE2", which="tissue")
print(f"Expression across {len(tissue_expr)} tissues")
# Correlated genes from ARCHS4
correlated = gget.archs4("ACE2", which="correlation")
print(f"Top correlated gene: {correlated.iloc[0]['gene_symbol']}")
import gget
# Single-cell data from CELLxGENE (requires gget setup cellxgene)
adata = gget.cellxgene(
gene=["ACE2", "TMPRSS2"],
tissue="lung",
cell_type="epithelial cell",
census_version="2023-07-25" # pin version for reproducibility
)
print(f"Cells: {adata.n_obs}, Genes: {adata.n_vars}")
# Orthologs and expression from Bgee
orthologs = gget.bgee("ENSG00000169194", type="orthologs")
print(f"Orthologs in {len(orthologs)} species")
Module 5: Disease & Drug Associations (opentargets, enrichr)
Disease associations, drug targets, enrichment analysis.
import gget
# Disease associations from OpenTargets
diseases = gget.opentargets("ENSG00000169194", resource="diseases", limit=10)
print(f"Associated diseases: {len(diseases)}")
# Drug associations
drugs = gget.opentargets("ENSG00000169194", resource="drugs", limit=10)
print(f"Associated drugs: {len(drugs)}")
# OpenTargets resources: diseases, drugs, tractability, pharmacogenetics,
# expression, depmap, interactions
import gget
# Enrichment analysis via Enrichr
# Database shortcuts: 'pathway' (KEGG), 'transcription' (ChEA),
# 'ontology' (GO_BP), 'diseases_drugs' (GWAS), 'celltypes' (PanglaoDB)
enrichment = gget.enrichr(
["ACE2", "AGT", "AGTR1", "TMPRSS2", "DPP4"],
database="ontology"
)
print(f"Enriched terms: {len(enrichment)}")
print(enrichment[["Term", "Adjusted P-value"]].head())
Module 6: Cancer Genomics (cbio, cosmic)
Cancer mutations, copy number alterations, and somatic mutation databases.
import gget
# Search cBioPortal studies
studies = gget.cbio_search(["breast", "lung"])
print(f"Studies found: {len(studies)}")
# Plot cancer genomics heatmap
gget.cbio_plot(
["msk_impact_2017"],
["AKT1", "ALK", "BRAF"],
stratification="tissue",
variation_type="mutation_occurrences"
)
import gget
# COSMIC: requires account + local database download
# First-time: gget.cosmic(searchterm="", download_cosmic=True,
# email="[email protected]", password="xxx", cosmic_project="cancer")
cosmic_results = gget.cosmic("EGFR", cosmic_tsv_path="cosmic_data.tsv", limit=10)
print(f"COSMIC mutations: {len(cosmic_results)}")
Module 7: Mutation Generation & Utilities (mutate, setup)
Generate mutated sequences and manage module dependencies.
import gget
import pandas as pd
# Generate mutated sequences from mutation annotations
mutations_df = pd.DataFrame({
"seq_ID": ["seq1", "seq1"],
"mutation": ["c.4G>T", "c.10del"]
})
mutated = gget.mutate(["ATCGCTAAGCTGATCG"], mutations=mutations_df)
print(f"Generated {len(mutated)} mutated sequences")
Key Concepts
Module Overview
gget organizes 20+ modules by domain. Python interface uses gget.<module>():
| Domain | Modules | Primary Database |
|---|---|---|
| Gene reference | ref, search, info, seq | Ensembl, UniProt, NCBI |
| Sequence alignment | blast, blat, muscle, diamond | NCBI BLAST, UCSC, local |
| Protein structure | pdb, alphafold, elm | RCSB PDB, AlphaFold2, ELM |
| Expression | archs4, cellxgene, bgee | ARCHS4, CZ CELLxGENE, Bgee |
| Disease/drugs | opentargets, enrichr | OpenTargets, Enrichr |
| Cancer | cbio, cosmic | cBioPortal, COSMIC |
| Utilities | mutate, setup, gpt | local / OpenAI |
Output Formats
| Context | Default Format | Alternatives |
|---|---|---|
| Python | DataFrame or dict | json=True for JSON; save=True to file |
| CLI | JSON | -csv for CSV; -o file to save |
| Sequences | FASTA (seq, mutate) | -- |
| Structures | PDB file (pdb, alphafold) | JSON alignment error data |
| Single-cell | AnnData object (cellxgene) | meta_only=True for metadata only |
| Visualization | PNG (cbio plot) | show=True for interactive display |
Enrichr Database Shortcuts
| Shortcut | Full Database Name |
|---|---|
'pathway' | KEGG_2021_Human |
'transcription' | ChEA_2016 |
'ontology' | GO_Biological_Process_2021 |
'diseases_drugs' | GWAS_Catalog_2019 |
'celltypes' | PanglaoDB_Augmented_2021 |
Custom libraries: pass any Enrichr library name directly (e.g., "Jensen_TISSUES").
OpenTargets Resources
| Resource | Description |
|---|---|
diseases | Disease associations with evidence scores |
drugs | Drug associations and clinical trial data |
tractability | Target tractability assessment |
pharmacogenetics | Pharmacogenetic variants |
expression | Baseline tissue expression |
depmap | DepMap gene-disease effects |
interactions | Protein-protein interactions |
Reproducibility
Pin database versions for consistent results across analyses:
import gget
# Pin Ensembl release
ref = gget.ref("homo_sapiens", release=112)
# Pin CELLxGENE Census version
adata = gget.cellxgene(gene=["ACE2"], census_version="2023-07-25")
# Always record gget version
print(f"gget version: {gget.__version__}")
Common Workflows
Workflow 1: Gene Discovery to Functional Analysis
Goal: Find genes of interest, get their sequences, and perform enrichment analysis.
import gget
# 1. Search for genes
results = gget.search(["GABA", "receptor"], species="homo_sapiens")
gene_ids = results["ensembl_id"].tolist()[:10]
# 2. Get detailed information
info = gget.info(gene_ids)
print(f"Retrieved info for {len(info)} genes")
# 3. Get protein sequences
sequences = gget.seq(gene_ids, translate=True)
# 4. Find correlated genes
correlated = gget.archs4(info.index[0], which="correlation")
# 5. Enrichment analysis on correlated genes
gene_list = correlated["gene_symbol"].tolist()[:50]
enrichment = gget.enrichr(gene_list, database="ontology")
print(f"Top enriched term: {enrichment.iloc[0]['Term']}")
Workflow 2: Target Validation for Drug Discovery
Goal: Investigate a gene's disease associations, druggability, and cancer mutations.
import gget
gene_id = "ENSG00000169194" # ZBTB16
# 1. Disease associations
diseases = gget.opentargets(gene_id, resource="diseases", limit=20)
# 2. Drug associations
drugs = gget.opentargets(gene_id, resource="drugs")
# 3. Tractability assessment
tractability = gget.opentargets(gene_id, resource="tractability")
# 4. Protein interactions
interactions = gget.opentargets(gene_id, resource="interactions")
print(f"Diseases: {len(diseases)}, Drugs: {len(drugs)}, Interactions: {len(interactions)}")
# 5. Cancer genomics
gget.cbio_plot(["msk_impact_2017"], ["ZBTB16"], stratification="cancer_type")
Workflow 3: Comparative Genomics
Goal: Compare a gene across species using orthologs and sequence alignment.
import gget
# 1. Find orthologs
orthologs = gget.bgee("ENSG00000169194", type="orthologs")
# 2. Get sequences for human and mouse
human_seq = gget.seq("ENSG00000169194", translate=True)
mouse_seq = gget.seq("ENSMUSG00000026091", translate=True)
# 3. Align sequences
alignment = gget.muscle([human_seq, mouse_seq])
# 4. Get human protein structure from PDB
pdb_structure = gget.pdb("7S7U")
print("Comparative analysis complete")
Key Parameters
| Parameter | Module(s) | Default | Range / Options | Effect |
|---|---|---|---|---|
species | search, archs4, cellxgene, enrichr | "homo_sapiens" | Any Ensembl species; shortcuts: 'human', 'mouse' | Target organism |
limit | blast, opentargets, cosmic | 50 / 100 | 1-1000 | Maximum results returned |
database | blast, enrichr | varies | blast: nt/nr/swissprot/pdbaa; enrichr: shortcuts or library names | Target database for query |
which | ref, archs4 | varies | ref: gtf,cdna,dna,cds,pep; archs4: correlation,tissue | Data type to retrieve |
translate | seq | False | True/False | Return amino acid instead of nucleotide sequences |
resource | opentargets | "diseases" | diseases, drugs, tractability, pharmacogenetics, expression, depmap, interactions | OpenTargets data type |
release | ref, search | latest | Integer Ensembl release number | Pin database version for reproducibility |
census_version | cellxgene | "stable" | "stable", "latest", date string | Pin CELLxGENE Census version |
sensitivity | diamond, elm | "very-sensitive" | fast to ultra-sensitive | Alignment sensitivity vs speed |
threads | diamond, elm | 1 | 1-N | CPU threads for alignment |
multimer_recycles | alphafold | 3 | 3-20 | Higher = more accurate multimer prediction |
Best Practices
-
Pin database versions for reproducibility: Use
release=112for Ensembl andcensus_version="2023-07-25"for CELLxGENE to ensure consistent results across analyses. -
Rate-limit batch queries: gget queries remote APIs. Add
time.sleep(2)between BLAST/BLAT queries in loops. Forgget.info(), limit to ~1000 IDs per call. -
Keep gget updated: Databases change their structure biweekly. Run
pip install --upgrade ggetregularly to avoid breakage from schema changes. -
Use Python interface for pipelines, CLI for exploration: Python functions return DataFrames suitable for chaining. CLI with
-csvis better for quick one-off lookups. -
Check PDB before running AlphaFold:
gget.pdb()is instant; AlphaFold prediction takes minutes to hours. Always check if the structure already exists in PDB. -
Use database shortcuts in enrichr: The shortcuts (
'pathway','ontology', etc.) map to curated Enrichr libraries. For custom analyses, pass any Enrichr library name directly. -
Cache cBioPortal data for repeated analyses: Use
data_dir="./cache"parameter to avoid re-downloading large cancer genomics datasets.
Common Recipes
Recipe: Batch Gene Information Retrieval
When to use: Need information for many genes at once (up to ~1000 IDs per call).
import gget
import time
gene_ids = ["ENSG00000012048", "ENSG00000139618", "ENSG00000141510"]
info = gget.info(gene_ids)
info.to_csv("gene_info_batch.csv")
print(f"Saved info for {len(info)} genes")
# For >1000 genes, batch with rate limiting
all_ids = [f"ENSG{i:011d}" for i in range(2000)]
results = []
for i in range(0, len(all_ids), 500):
batch = all_ids[i:i+500]
results.append(gget.info(batch))
time.sleep(1)
Recipe: Custom Enrichment with Background
When to use: Running enrichment against a custom background gene set.
import gget
# Use specific Enrichr library with background genes
enrichment = gget.enrichr(
["ACE2", "AGT", "AGTR1"],
database="Jensen_TISSUES",
background_list=["ACE2", "AGT", "AGTR1", "TP53", "BRCA1", "MYC"]
)
print(enrichment[["Term", "Adjusted P-value"]].head())
Recipe: AlphaFold Structure Prediction with Visualization
When to use: Predicting and visualizing protein structures with confidence coloring.
import gget
# Predict with visualization (PAE + 3D structure)
result = gget.alphafold(
"MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR",
plot=True,
show_sidechains=True,
relax=True # AMBER relaxation for final structure
)
# Output: PDB file + predicted aligned error (PAE) JSON
# PAE heatmap auto-generated with plot=True
Recipe: Download Reference Genome for RNA-seq Pipeline
When to use: Setting up reference files for RNA-seq alignment pipelines.
# Download GTF and cDNA for human (specific release)
gget ref -w gtf -w cdna -d -r 112 homo_sapiens
# Download genome DNA
gget ref -w dna -d homo_sapiens
Troubleshooting
| Problem | Cause | Solution |
|---|---|---|
ModuleNotFoundError: gget | Package not installed | pip install gget in clean virtual environment |
gget setup alphafold fails | Python version incompatibility | Use Python 3.8-3.10; check gget --version |
| Empty BLAST results | Sequence too short or no matches | Try longer sequence, different database, or megablast_off=True |
cellxgene gene not found | Case-sensitive gene symbols | Use 'ACE2' for human, 'Ace2' for mouse (exact capitalization required) |
gget info timeout | Too many IDs at once | Limit to ~1000 Ensembl IDs per call; batch with time.sleep() |
| Database structure changed | gget databases update biweekly | pip install --upgrade gget |
| COSMIC authentication error | Missing or expired credentials | Re-enter email/password; check COSMIC account status |
| AlphaFold out of memory | Protein too long for GPU memory | Use shorter sequences or split into domains |
| Different results on re-run | Database updated between runs | Pin versions: release=112 for Ensembl, census_version for CELLxGENE |
Bundled Resources
2 reference files provide extended coverage of capabilities from the original 3 reference files and 3 script files:
-
references/module_parameters.md— Consolidates module_reference.md (468 lines). Covers: detailed parameter tables for all 15+ modules with types, defaults, and return value descriptions; CLI vs Python interface differences; setup requirements per module. Relocated inline: most-used module parameters (Core API code blocks), output format summary (Key Concepts table). Omitted: gget gpt module details — trivial OpenAI wrapper, not genomics-specific. -
references/databases_workflows.md— Consolidates database_info.md (301 lines) and workflows.md (815 lines). Covers: complete database directory with update frequencies and citation info, extended workflow examples (building reference indices, disease-drug pipeline, multi-species comparative analysis), data consistency and reproducibility guidance. Relocated inline: core database overview (Key Concepts table), top 3 workflows (Common Workflows), reproducibility patterns (Key Concepts). Omitted: scripts/ content (3 files, 590 lines total) — thin wrappers around gget API calls for CLI automation; core patterns absorbed into Core API and Common Workflows.
Related Skills
- biopython — advanced BLAST parameters, batch sequence processing, GenBank record parsing
- bioservices — programmatic multi-database queries with built-in rate limiting (UniProt, KEGG, ChEMBL)
- anndata-data-structure — working with AnnData objects returned by
gget.cellxgene() - enrichr — deeper enrichment analysis with custom gene set libraries
References
- gget documentation — official docs and tutorials
- gget GitHub — source code, issues
- Luebbert, L. & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836
What ships with it: 2 files
30.4 KB alongside SKILL.md
references/
- databases_workflows.md18.2 KB
- module_parameters.md12.2 KB